General Information

  • ID:  hor006537
  • Uniprot ID:  P26339
  • Protein name:  Pancreastatin
  • Gene name:  Chga
  • Organism:  Mus musculus (Mouse)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding
  • GO BP:  GO:0001934 positive regulation of protein phosphorylation; GO:0002026 regulation of the force of heart contraction; GO:0002551 mast cell chemotaxis; GO:0006996 organelle organization; GO:0033366 protein localization to secretory granule; GO:0033604 negative regulation of catecholamine secretion; GO:0042742 defense response to bacterium; GO:0043303 mast cell degranulation; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045576 mast cell activation; GO:0045907 positive regulation of vasoconstriction; GO:0046676 negative regulation of insulin secretion; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0051480 regulation of cytosolic calcium ion concentration; GO:0060452 positive regulation of cardiac muscle contraction; GO:0086030 adenylate cyclase-activating adrenergic receptor signaling pathway involved in cardiac muscle relaxation; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway; GO:1901899 positive regulation of relaxation of cardiac muscle; GO:2000707 positive regulation of dense core granule biogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030133 transport vesicle; GO:0030141 secretory granule; GO:0031410 cytoplasmic vesicle; GO:0042583 chromaffin granule; GO:0048471 perinuclear region of cytoplasm; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  DDGQSDSQAVDGDGKTEASEALPSEGKGELEHSQQEEDGEEAMVGTPQGLFPQG
  • Length:  54
  • Propeptide:  MRSTAVLALLLCAGQVFALPVNSPMTKGDTKVMKCVLEVISDSLSKPSPMPVSPECLETLQGDERILSILRHQNLLKELQDLALQGAKERAQQPLKQQQPPKQQQQQQQQQQQEQQHSSFEDELSEVFENQSPDAKHRDAAAEVPSRDTMEKRKDSDKGQQDGFEATTEGPRPQAFPEPNQESPMMGDSESPGEDTATNTQSPTSLPSQEHVDPQATGDSERGLSAQQQARKAKQEEKEEEEEEEAVAREKAGPEEVPTAASSSHFHAGYKAIQKDDGQSDSQAVDGDGKTEASEALPSEGKGELEHSQQEEDGEEAMVGTPQGLFPQGGKGRELEHKQEEEEEEEERLSREWEDKRWSRMDQLAKELTAEKRLEGEDDPDRSMKLSFRTRAYGFRDPGPQLRRGWRPSSREDSVEARSDFEEKKEEEGSANRRAEDQELESLSAIEAELEKVAHQLQALRRG
  • Signal peptide:  MRSTAVLALLLCAGQVFA
  • Modification:  T7 Phosphoserine;T33 Phosphoserine;T54 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Pancreastatin]: Strongly inhibits glucose induced insulin release from the pancreas.; [Catestatin]: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist. Can induce mast cell migration, degranulation and production of cytokines and chemokines.
  • Mechanism:  Binds calcium with a low-affinity.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P26339-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006537_AF2.pdbhor006537_ESM.pdb

Physical Information

Mass: 652126 Formula: C227H350N64O98S
Absent amino acids: CINRWY Common amino acids: EG
pI: 3.51 Basic residues: 3
Polar residues: 16 Hydrophobic residues: 10
Hydrophobicity: -123.33 Boman Index: -14088
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 39.81
Instability Index: 6512.59 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2071596
  • Title:  Structure and function of the chromogranin A gene. Clues to evolution and tissue-specific expression.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  12388744
  • Title:  Identification of a chromogranin A domain that mediates binding to secretogranin III and targeting to secretory granules in pituitary cells and pancreatic beta-cells.
  • PubMed ID:  21183079
  • Title:  A tissue-specific atlas of mouse protein phosphorylation and expression.
  • PubMed ID:  21537909
  • Title:  Role of pGlu-serpinin, a novel chromogranin A-derived peptide in inhibition of cell death.
  • PubMed ID:  21436258
  • Title:  Serpinin: a novel chromogranin A-derived, secreted peptide up-regulates protease nexin-1 expression and granule biogenesis in endocrine cells.